Add to favorite | About LookChemicals
Chemicals: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Products > 120796-99-8

120796-99-8 Endothelin 1 (swine),big (9CI)

Name: Endothelin 1 (swine),big (9CI)
Synonyms: Endothelin1 (pig), big;33,34,49,50-Tetrathia-2,5,8,11,14,17,20,23,26,29,37,40,43,46-tetradecaazabicyclo[23.22.4]henpentacontane,cyclic peptide deriv.; Big porcine endothelin(1-39); Endothelin-39 (pig); Humanproendothelin-1; Porcine big endothelin; Porcine big endothelin(1-39); Porcinebig endothelin-1; Porcine proendothelin(1-39)
CAS Number:120796-99-8
Molecular Formula:C193H289 N49 O58 S5
Molecular Weight:0
EINECS:
Density:
Boiling Point:
Flash Point:
Safety Description:
WGK Germany 3

liansport Information:

Search:

Related Suppliers

CAS No.120796-99-8 H-CYS-SER-CYS-SER-SER-LEU-MET-ASP-LYS-GLU-CYS-VAL-TYR-PHE-CYS-HIS-LEU-ASP-ILE-ILE-TRP-VAL-ASN-THR-PRO-GLU-HIS-ILE-VAL-PRO-TYR-GLY-LEU-GLY-SER-PRO-SER-ARG-SER-OH

Assay:99% Appearance:powder Package:Inside plastic outside Storage:Store at -20掳C Transportation:We ship goods via DHL, Fedex, UPS, TNT, China post, NL Post and other couriers, weight from 1g to 1000kg or even bulker Application:Scientific research 

Min. Order:1Gram

Supplier:Hebei Nengqian Chemical Import and Export Co., LTD [ China (Mainland)]

CAS No.120796-99-8 Big Endothelin 1 (1-39), porcine;CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS(Disulfidebridge:1-15and3-11)

Assay:99.0% Appearance:liquid Package:Grams, Kilograms Storage:Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials. Transportation:According to customer request Application:For R&D and commerical use 

Min. Order:100Gram

Supplier:Chemlyte Solutions [ China (Mainland)]

CAS No.120796-99-8 H-CYS-SER-CYS-SER-SER-LEU-MET-ASP-LYS-GLU-CYS-VAL-TYR-PHE-CYS-HIS-LEU-ASP-ILE-ILE-TRP-VAL-ASN-THR-PRO-GLU-HIS-ILE-VAL-PRO-TYR-GLY-LEU-GLY-SER-PRO-SER-ARG-SER-OH

Assay:99% Package:box or opp package Storage:cool drum  Transportation:air or sea Application:H-CYS-SER-CYS-SER-SER-LEU-MET-ASP-LYS-GLU-CYS-VAL-TYR-PHE-CYS-HIS-LEU-ASP-ILE-ILE-TRP-VAL-ASN-THR-PRO-GLU-HIS-ILE-VAL-PRO-TYR-GLY-LEU-GLY-SER-PRO-SER-ARG-SER-OH 

Min. Order:1Milligram

Supplier:weifang yangxu group co.,ltd [ China (Mainland)]

CAS No.120796-99-8 Manufacturer supply CAS 120796-99-8 with best quality

Assay:99% Appearance:White powder Package: [Packaging]20mg, 50mg,100mg,1g,10g,100g,according to customers' requirements Storage: should be stored in a well-closed container at low temperature, keep away from moisture, heat and light. Transportation:1. Samples 1kg-10kg are shipped by international express. 2. 50kg-100kg of goods are transported by dedicated line logistics. 3. Cargo 100kg-1ton is transported by dedicated line logistics. Application:Chemical raw materials, pharmaceutical intermediates, cosmetic raw materials, etc. 

Min. Order:1Kilogram

Supplier:Zhuozhou Wenxi import and Export Co., Ltd [ China (Mainland)]

CAS No.120796-99-8 Endothelin 1 (swine), big

Assay:95% Storage:Store at -20掳C Application:For research use only. 

Min. Order:0

Supplier:BOC Sciences [ United States]

Home | About us | Contact us | Link | Add to favorite
Copyright 2008 LookChemicals.com
All Rights Reserved